45% Off Your Order*
Save Now!!
Cagrilintide 5mg
Buy Cagrilintide 5mg :
| Unit Size | 5mg/vial |
| Unit Quantity | 1 vial |
| Purity (Mass Spectrometry and UV) | 99.78% |
| Sequence | XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP |
| Molecular Formula | C194H312N54O59S2 | Appearance | Lyophilized White Powder |
| Source | Chemical Synthesis |
| Storage | Lyophilized Cagrilintide is stable at room Temperature for 90 days, however it is best to store in a freezer below - 8c for any extended period of time.. |
| Terms | The products we offer are intended for laboratory research use only. Please familiarize yourself with our terms of service prior to ordering. |
Early access to sales & product releases.
Earn 100 points for subscribing to our newsletter when you create an account.