45% Off Your Order*
Save Now!!

| Unit Size | 10 mg/vial |
| Unit Quantity | 1 vial |
| Purity (Mass Spectrometry and UV) | 99.88% |
| Sequence (Cagrilintide) | XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP |
| Sequence (Semaglutide) | HXEGTFTSDVSSYLEGQAAKEFIAWLVRGRG |
| Molecular Formula (Cagrilintide) |
C194H312N54O59S2 |
| Molecular Formula (Semaglutide) | C187H291N45O59 |
| Appearance | Lyophilized White Powder |
| Source | Chemical Synthesis |
| Storage | Lyophilized Blend CagriSema is stable at roomTemperature for 90 days, however it is best to store in a freezer below - 8c for any extended period of time. |
| Terms | The products we offer are intended for laboratory research use only. Please familiarize yourself with our terms of service prior to ordering. |